VIMSS2168263 has 89 amino acids
Query: RemA-like [M=73]
Accession: PF04025.16
Description: Extracellular matrix regulatory protein A-like
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.9e-43 130.8 0.5 9.4e-43 130.6 0.5 1.1 1 VIMSS2168263
Domain annotation for each sequence (and alignments):
>> VIMSS2168263
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 130.6 0.5 9.4e-43 9.4e-43 1 73 [] 5 77 .. 5 77 .. 0.99
Alignments for each domain:
== domain 1 score: 130.6 bits; conditional E-value: 9.4e-43
RemA-like 1 liniGfgnvVnadriiaivspdsapikrliqeakeegklidaTqgrktrsviitdsghviLSalqpetlakRl 73
liniGfgn+V+a+r++aivsp+sapikr+iqea+++g+lidaT+gr+tr+viitds+hviLSa+qpet+a+Rl
VIMSS2168263 5 LINIGFGNIVSANRLVAIVSPESAPIKRIIQEARDRGMLIDATYGRRTRAVIITDSDHVILSAVQPETVAHRL 77
8**********************************************************************97 PP
Or compare VIMSS2168263 to CDD or PaperBLAST