VIMSS3532051 has 101 amino acids
Query: RemA-like [M=73]
Accession: PF04025.16
Description: Extracellular matrix regulatory protein A-like
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-42 130.2 0.8 1.4e-42 130.0 0.8 1.1 1 VIMSS3532051
Domain annotation for each sequence (and alignments):
>> VIMSS3532051
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 130.0 0.8 1.4e-42 1.4e-42 1 72 [. 9 80 .. 9 81 .. 0.99
Alignments for each domain:
== domain 1 score: 130.0 bits; conditional E-value: 1.4e-42
RemA-like 1 liniGfgnvVnadriiaivspdsapikrliqeakeegklidaTqgrktrsviitdsghviLSalqpetlakR 72
liniGfgn+V+a+r+iaivspdsapikr+iqea+e+g+lidaT+gr+tr+viitds+hviLSa+qpet+a+R
VIMSS3532051 9 LINIGFGNIVSANRLIAIVSPDSAPIKRIIQEARERGMLIDATYGRRTRAVIITDSDHVILSAVQPETVAHR 80
8**********************************************************************9 PP
Or compare VIMSS3532051 to CDD or PaperBLAST