VIMSS3419474 has 218 amino acids
Query: DUF374 [M=69]
Accession: PF04028.17
Description: Domain of unknown function (DUF374)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.6e-27 79.5 0.0 9e-27 78.8 0.0 1.4 1 VIMSS3419474
Domain annotation for each sequence (and alignments):
>> VIMSS3419474
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 78.8 0.0 9e-27 9e-27 5 68 .. 74 137 .. 70 138 .. 0.97
Alignments for each domain:
== domain 1 score: 78.8 bits; conditional E-value: 9e-27
DUF374 5 kkkiaaliSrsrDGeliarvlerlgiktvrGSssrggaralremlralkeGesiaiTpDGPrGP 68
+++i+aliS + DG ++++++e++g++++ GS++r+ alr+++++l +G +i++TpDGP+GP
VIMSS3419474 74 HRNIYALISPHLDGAILNNLVEKFGCRVIVGSTNRNPIGALRNIISKLSQGANIIVTPDGPKGP 137
89************************************************************** PP
Or compare VIMSS3419474 to CDD or PaperBLAST