VIMSS614152 has 218 amino acids
Query: DUF374 [M=69]
Accession: PF04028.17
Description: Domain of unknown function (DUF374)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.8e-26 77.9 0.0 3.2e-26 77.1 0.0 1.5 1 VIMSS614152
Domain annotation for each sequence (and alignments):
>> VIMSS614152
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 77.1 0.0 3.2e-26 3.2e-26 3 68 .. 72 137 .. 70 138 .. 0.97
Alignments for each domain:
== domain 1 score: 77.1 bits; conditional E-value: 3.2e-26
DUF374 3 krkkkiaaliSrsrDGeliarvlerlgiktvrGSssrggaralremlralkeGesiaiTpDGPrGP 68
+ +++i+aliS + DG++++ ++ ++g++++ GS++++ alr+++ +l +G +i++TpDGP+GP
VIMSS614152 72 TGHRNIYALISPHLDGKILNAIVGKFGCQVIVGSTNKNSIVALRNIIGKLSQGANIIVTPDGPKGP 137
5689************************************************************** PP
Or compare VIMSS614152 to CDD or PaperBLAST