VIMSS661034 has 238 amino acids
Query: DUF374 [M=69]
Accession: PF04028.17
Description: Domain of unknown function (DUF374)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.5e-31 93.0 0.0 5.5e-31 92.3 0.0 1.3 1 VIMSS661034
Domain annotation for each sequence (and alignments):
>> VIMSS661034
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 92.3 0.0 5.5e-31 5.5e-31 1 69 [] 76 144 .. 76 144 .. 0.98
Alignments for each domain:
== domain 1 score: 92.3 bits; conditional E-value: 5.5e-31
DUF374 1 lrkrkkkiaaliSrsrDGeliarvlerlgiktvrGSssrggaralremlralkeGesiaiTpDGPrGPr 69
+ +r++++a+liS+s+DG++i++v++r+g ++rGSss+gg +al++++ +lk++ +aiTpDGPrGP+
VIMSS661034 76 YLNRNERMAVLISESKDGDFINQVVHRFGNYSIRGSSSKGGSKALKALIVHLKKNFPAAITPDGPRGPA 144
5689****************************************************************6 PP
Or compare VIMSS661034 to CDD or PaperBLAST