PaperBLAST – Find papers about a protein or its homologs

 

Align WP_000053539.1 to PF04028 (DUF374)

WP_000053539.1 has 217 amino acids

Query:       DUF374  [M=69]
Accession:   PF04028.17
Description: Domain of unknown function (DUF374)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
      2e-30   90.5   0.0    2.9e-30   90.0   0.0    1.3  1  WP_000053539.1  


Domain annotation for each sequence (and alignments):
>> WP_000053539.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   90.0   0.0   2.9e-30   2.9e-30       4      69 .]      65     130 ..      62     130 .. 0.97

  Alignments for each domain:
  == domain 1  score: 90.0 bits;  conditional E-value: 2.9e-30
          DUF374   4 rkkkiaaliSrsrDGeliarvlerlgiktvrGSssrggaralremlralkeGesiaiTpDGPrGPr 69 
                     +k+ +++++S+++DG+++a ++e++g+k +rGSs++gg+++l+e l+ lkeG+++aiTpDGP+GPr
  WP_000053539.1  65 QKPSVYVIASQHFDGSIAAGLFESFGFKNIRGSSKKGGVKVLIEGLKRLKEGCDVAITPDGPKGPR 130
                     68899************************************************************8 PP



Or compare WP_000053539.1 to CDD or PaperBLAST