WP_011270428.1 has 218 amino acids
Query: DUF374 [M=69]
Accession: PF04028.17
Description: Domain of unknown function (DUF374)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.9e-26 76.8 0.0 6.5e-26 76.1 0.0 1.4 1 WP_011270428.1
Domain annotation for each sequence (and alignments):
>> WP_011270428.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 76.1 0.0 6.5e-26 6.5e-26 5 68 .. 74 137 .. 70 138 .. 0.97
Alignments for each domain:
== domain 1 score: 76.1 bits; conditional E-value: 6.5e-26
DUF374 5 kkkiaaliSrsrDGeliarvlerlgiktvrGSssrggaralremlralkeGesiaiTpDGPrGP 68
+++i+aliS + DG+++++++ ++g++++ GS++++ alr+++ +l +G +i++TpDGP+GP
WP_011270428.1 74 HRNIYALISPHLDGKILNDLVGKFGCRVIVGSTNKNPIGALRNIIGKLSQGANIIVTPDGPKGP 137
89************************************************************** PP
Or compare WP_011270428.1 to CDD or PaperBLAST