Q9BTY7 has 390 amino acids
Query: DUF384 [M=55]
Accession: PF04064.17
Description: Domain of unknown function (DUF384)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.2e-25 73.2 0.0 1.2e-24 72.3 0.0 1.5 1 Q9BTY7
Domain annotation for each sequence (and alignments):
>> Q9BTY7
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 72.3 0.0 1.2e-24 1.2e-24 1 54 [. 292 345 .. 292 346 .. 0.98
Alignments for each domain:
== domain 1 score: 72.3 bits; conditional E-value: 1.2e-24
DUF384 1 sLllLcttregReylRskgvYpilRelHkaeedekvreacerlVqlLirdEeee 54
+++lL++t gR+ +R++g+Y ilRelH +e +++vr ace+l+q+Li+dE+e
Q9BTY7 292 AIMLLTATAPGRQQVRDQGAYLILRELHSWEPEPDVRTACEKLIQVLIGDEPER 345
79**************************************************96 PP
Or compare Q9BTY7 to CDD or PaperBLAST