XP_001594398.1 has 354 amino acids
Query: DUF384 [M=55]
Accession: PF04064.17
Description: Domain of unknown function (DUF384)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4e-29 86.6 5.6 5.5e-29 86.2 4.0 2.0 2 XP_001594398.1
Domain annotation for each sequence (and alignments):
>> XP_001594398.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -1.3 0.0 0.12 0.12 6 21 .. 134 149 .. 133 150 .. 0.76
2 ! 86.2 4.0 5.5e-29 5.5e-29 1 55 [] 246 300 .. 246 300 .. 0.98
Alignments for each domain:
== domain 1 score: -1.3 bits; conditional E-value: 0.12
DUF384 6 cttregReylRskgvY 21
+ +egR+y+ k+ Y
XP_001594398.1 134 AKHEEGRKYFLTKQEY 149
66789****9877766 PP
== domain 2 score: 86.2 bits; conditional E-value: 5.5e-29
DUF384 1 sLllLcttregReylRskgvYpilRelHkaeedekvreacerlVqlLirdEeeee 55
+L+lL+ttregR+++R+ +vYpi+RelH++ + +++reacerlVq+L+rdEe+ee
XP_001594398.1 246 TLMLLTTTREGRDIMREIKVYPIIRELHLKIDHDEMREACERLVQVLMRDEEGEE 300
8***************************************************985 PP
Or compare XP_001594398.1 to CDD or PaperBLAST