VIMSS104000 has 180 amino acids
Query: DUF402 [M=68]
Accession: PF04167.17
Description: Protein of unknown function (DUF402)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.7e-24 69.7 4.1 9.7e-24 69.7 4.1 1.7 2 VIMSS104000
Domain annotation for each sequence (and alignments):
>> VIMSS104000
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 69.7 4.1 9.7e-24 9.7e-24 2 68 .] 63 127 .. 62 127 .. 0.96
2 ? -3.3 0.2 0.6 0.6 48 54 .. 138 144 .. 138 151 .. 0.61
Alignments for each domain:
== domain 1 score: 69.7 bits; conditional E-value: 9.7e-24
DUF402 2 lalwllplgewynvtkfldedgrlkgwYvniatppergegtvkyiDlyLDvvvypdgevevlDedEL 68
+a+++++ + w+nv+++++e +++++Y+n+++p +e+++kyiD++LD++vyp+g++++lDedE+
VIMSS104000 63 PAIVYFHSEYWFNVICMFRE--DGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKYHLLDEDEY 127
789*****************..7***********99988***************************7 PP
== domain 2 score: -3.3 bits; conditional E-value: 0.6
DUF402 48 lyLDvvv 54
+++D++
VIMSS104000 138 HDIDIIL 144
6889985 PP
Or compare VIMSS104000 to CDD or PaperBLAST