VIMSS1292172 has 214 amino acids
Query: DUF402 [M=68] Accession: PF04167.17 Description: Protein of unknown function (DUF402) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-21 61.7 0.3 5.4e-21 60.9 0.3 1.5 1 VIMSS1292172 Domain annotation for each sequence (and alignments): >> VIMSS1292172 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.9 0.3 5.4e-21 5.4e-21 1 68 [] 61 128 .. 61 128 .. 0.95 Alignments for each domain: == domain 1 score: 60.9 bits; conditional E-value: 5.4e-21 DUF402 1 dlalwllplgewynvtkfldedgrlkgwYvniatppergegtvkyiDlyLDvvvypdgevevlDedEL 68 +++l++lp++++y++t+++d++g+ +++Y++i+ + +g +++Dl LDv p+ge+e++Ded+L VIMSS1292172 61 YKWLQILPEKKRYSITVMFDNKGNPLEYYFDINIKNITQKGNARTVDLCLDVLALPSGEYELVDEDDL 128 789*******************************97776699************************97 PP
Or compare VIMSS1292172 to CDD or PaperBLAST