VIMSS3706187 has 214 amino acids
Query: DUF402 [M=68] Accession: PF04167.17 Description: Protein of unknown function (DUF402) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-20 58.5 0.2 5.6e-20 57.6 0.2 1.5 1 VIMSS3706187 Domain annotation for each sequence (and alignments): >> VIMSS3706187 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 57.6 0.2 5.6e-20 5.6e-20 1 68 [] 61 128 .. 61 128 .. 0.95 Alignments for each domain: == domain 1 score: 57.6 bits; conditional E-value: 5.6e-20 DUF402 1 dlalwllplgewynvtkfldedgrlkgwYvniatppergegtvkyiDlyLDvvvypdgevevlDedEL 68 +++l++lp++++y++t+++d++g+ +++Y++i+ + +g ++Dl LDv p+ge+e++Ded+L VIMSS3706187 61 YKWLQILPEKKRYSITVMFDNKGNPLEYYFDINIKNITQKGNACTVDLCLDVLALPSGEYELVDEDDL 128 789*******************************97776699************************97 PP
Or compare VIMSS3706187 to CDD or PaperBLAST