VIMSS37400 has 176 amino acids
Query: DUF402 [M=68] Accession: PF04167.17 Description: Protein of unknown function (DUF402) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-24 71.2 2.0 5.6e-24 70.4 2.0 1.4 1 VIMSS37400 Domain annotation for each sequence (and alignments): >> VIMSS37400 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 70.4 2.0 5.6e-24 5.6e-24 2 68 .] 60 124 .. 59 124 .. 0.95 Alignments for each domain: == domain 1 score: 70.4 bits; conditional E-value: 5.6e-24 DUF402 2 lalwllplgewynvtkfldedgrlkgwYvniatppergegtvkyiDlyLDvvvypdgevevlDedEL 68 +a+++++ +w+nv+ +l+e +++++Y+ni++p ++ +++kyiD++LDv+v+pd+++++lDedE+ VIMSS37400 60 PAICYFHARQWFNVIGMLRE--DGVHYYCNISSPFAYDGEAIKYIDYDLDVKVFPDMTYNILDEDEY 124 799*****************..7***********7776699*************************7 PP
Or compare VIMSS37400 to CDD or PaperBLAST