WP_002355538.1 has 177 amino acids
Query: DUF402 [M=68]
Accession: PF04167.17
Description: Protein of unknown function (DUF402)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.6e-23 69.0 3.0 1.6e-23 69.0 3.0 2.0 2 WP_002355538.1
Domain annotation for each sequence (and alignments):
>> WP_002355538.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 69.0 3.0 1.6e-23 1.6e-23 2 68 .] 60 124 .. 59 124 .. 0.96
2 ? -1.1 0.1 0.12 0.12 15 32 .. 149 166 .. 139 172 .. 0.68
Alignments for each domain:
== domain 1 score: 69.0 bits; conditional E-value: 1.6e-23
DUF402 2 lalwllplgewynvtkfldedgrlkgwYvniatppergegtvkyiDlyLDvvvypdgevevlDedEL 68
+a+++++++ w+n++++++e +++ +Y+n+a+p ++++++kyiD++LD++v+pdge ++lD+dE+
WP_002355538.1 60 PAIVYFHKKYWFNIIAMIRE--KGVSYYCNLASPYVLDDEALKYIDYDLDIKVFPDGEKRLLDVDEY 124
799****************9..9***********88888***************************7 PP
== domain 2 score: -1.1 bits; conditional E-value: 0.12
DUF402 15 vtkfldedgrlkgwYvni 32
v + +e+g + Yv+i
WP_002355538.1 149 VDWINNEKGPFSPEYVDI 166
556666677777777776 PP
Or compare WP_002355538.1 to CDD or PaperBLAST