PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS147183 to PF04219 (DUF413)

VIMSS147183 has 112 amino acids

Query:       DUF413  [M=90]
Accession:   PF04219.16
Description: Protein of unknown function, DUF
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    5.6e-43  131.2   0.1    6.6e-43  130.9   0.1    1.0  1  VIMSS147183  


Domain annotation for each sequence (and alignments):
>> VIMSS147183  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  130.9   0.1   6.6e-43   6.6e-43       1      88 [.      10      97 ..      10      99 .. 0.98

  Alignments for each domain:
  == domain 1  score: 130.9 bits;  conditional E-value: 6.6e-43
       DUF413  1 rFyDdknfprGfsrsGdFtikeaelLeqyGqalkaLeegelepvteeekqfvevvkgekaaeselekvWlkYlklirgkkrfhtlvgt 88
                 rF+D+k++prGfsr+GdFtikea+lLe++G+a+++L++g++epvteee++fv+v++ge+++ s+ ekvW+kY+ ++r++krfhtl+g 
  VIMSS147183 10 RFFDNKHYPRGFSRHGDFTIKEAQLLERHGYAFNELDSGKREPVTEEEQRFVAVCRGEREPVSAEEKVWSKYVIRTRQPKRFHTLSGG 97
                 8************************************************************************************986 PP



Or compare VIMSS147183 to CDD or PaperBLAST