WP_004146520.1 has 112 amino acids
Query: DUF413 [M=90]
Accession: PF04219.16
Description: Protein of unknown function, DUF
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2e-44 135.8 0.1 2.3e-44 135.6 0.1 1.1 1 WP_004146520.1
Domain annotation for each sequence (and alignments):
>> WP_004146520.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 135.6 0.1 2.3e-44 2.3e-44 1 88 [. 10 97 .. 10 99 .. 0.98
Alignments for each domain:
== domain 1 score: 135.6 bits; conditional E-value: 2.3e-44
DUF413 1 rFyDdknfprGfsrsGdFtikeaelLeqyGqalkaLeegelepvteeekqfvevvkgekaaeselekvWlkYlklirgkkrfhtlvgt 88
rF+D+kn+prGfsr+GdFtikea+lLe++G+a+++Le g++epvte+ekqfv+v++ge+++ +e+e+vW+kY+++i+++krfhtl+g
WP_004146520.1 10 RFFDNKNYPRGFSRHGDFTIKEAQLLERHGYAFNELELGKREPVTEDEKQFVSVCRGEREPVTEAERVWIKYMARIKRPKRFHTLSGG 97
8************************************************************************************986 PP
Or compare WP_004146520.1 to CDD or PaperBLAST