VIMSS15030 has 230 amino acids
Query: DUF421 [M=135]
Accession: PF04239.16
Description: YetF C-terminal domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.8e-21 62.3 0.0 2.4e-21 61.9 0.0 1.1 1 VIMSS15030
Domain annotation for each sequence (and alignments):
>> VIMSS15030
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 61.9 0.0 2.4e-21 2.4e-21 2 73 .. 97 167 .. 96 186 .. 0.93
Alignments for each domain:
== domain 1 score: 61.9 bits; conditional E-value: 2.4e-21
DUF421 2 kskklrrlidgkpivliknGkileenlkkarlsiddLlsqLRqqgifsisdVeyailEtnGqlsvlkkkekk 73
+s+kl++l++gkp+v+i++G++ ++l++++++ ++ ++LR +g+ ++ +V+ ailEtnGq+sv+ ++ +
VIMSS15030 97 HSEKLEDLLEGKPVVIIEDGELAWSKLNNSNMTEFEFFMELRLRGVEQLGQVRLAILETNGQISVYFFED-D 167
899**************************************************************98877.4 PP
Or compare VIMSS15030 to CDD or PaperBLAST