PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1746425 to PF04239 (DUF421)

VIMSS1746425 has 174 amino acids

Query:       DUF421  [M=108]
Accession:   PF04239.12
Description: Protein of unknown function (DUF421)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    4.1e-17   48.2   0.0    5.7e-17   47.8   0.0    1.2  1  VIMSS1746425  


Domain annotation for each sequence (and alignments):
>> VIMSS1746425  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   47.8   0.0   5.7e-17   5.7e-17       2      62 ..     103     163 ..     102     168 .. 0.94

  Alignments for each domain:
  == domain 1  score: 47.8 bits;  conditional E-value: 5.7e-17
        DUF421   2 lidgkpvvlienGkldeknlkklrltvddLleqLRqqgifslsdVkyailEtnGqlsvllk 62 
                   l + +p++li +G+l+ + ++++ ++ d++ ++LR +gi++++ V++a lE+nG +svl +
  VIMSS1746425 103 LAKARPKLLIADGELNTHVMRREFMSRDEIYSHLRLHGIEDMNRVRRAYLEPNGMISVLVD 163
                   56789*****************************************************865 PP



Or compare VIMSS1746425 to CDD or PaperBLAST