VIMSS1746425 has 174 amino acids
Query: DUF421 [M=135]
Accession: PF04239.16
Description: YetF C-terminal domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.3e-18 51.1 0.0 6.9e-18 50.7 0.0 1.1 1 VIMSS1746425
Domain annotation for each sequence (and alignments):
>> VIMSS1746425
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 50.7 0.0 6.9e-18 6.9e-18 3 70 .. 97 164 .. 95 170 .. 0.94
Alignments for each domain:
== domain 1 score: 50.7 bits; conditional E-value: 6.9e-18
DUF421 3 skklrrlidgkpivliknGkileenlkkarlsiddLlsqLRqqgifsisdVeyailEtnGqlsvlkkk 70
+ + rl + +p +li +G+++ + ++++ +s d++ s+LR +gi +++ V++a lE+nG +svl ++
VIMSS1746425 97 FPGFARLAKARPKLLIADGELNTHVMRREFMSRDEIYSHLRLHGIEDMNRVRRAYLEPNGMISVLVDS 164
5678999*********************************************************9765 PP
Or compare VIMSS1746425 to CDD or PaperBLAST