PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1789648 to PF04239 (DUF421)

VIMSS1789648 has 211 amino acids

Query:       DUF421  [M=108]
Accession:   PF04239.12
Description: Protein of unknown function (DUF421)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.6e-34  104.2   1.1    2.5e-34  103.6   1.1    1.3  1  VIMSS1789648  


Domain annotation for each sequence (and alignments):
>> VIMSS1789648  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  103.6   1.1   2.5e-34   2.5e-34       2     107 ..      89     190 ..      88     191 .. 0.96

  Alignments for each domain:
  == domain 1  score: 103.6 bits;  conditional E-value: 2.5e-34
        DUF421   2 lidgkpvvlienGkldeknlkklrltvddLleqLRqqgifslsdVkyailEtnGqlsvllkeekkpvtklplplivdGkiqkenLkkigkdeewLkk 98 
                   +idgkp +li++Gk+ ++++ ++++++++L+++LR++gi+++++Vk+ailE+nGql+ ++ +  ++++   +p+ivdG+ + + L+ i+kde wL++
  VIMSS1789648  89 IIDGKPLTLIQDGKVRVNECLRNGISANELMFKLRSNGIYEIHNVKRAILEQNGQLTLIEFGG-ENIK---YPIIVDGQANFDVLELIDKDEVWLEQ 181
                   79************************************************************9.6666...************************** PP

        DUF421  99 elkkkgikl 107
                   +++ +g+++
  VIMSS1789648 182 QINLQGYNQ 190
                   *****9985 PP



Or compare VIMSS1789648 to CDD or PaperBLAST