PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS302853 to PF04239 (DUF421)

VIMSS302853 has 230 amino acids

Query:       DUF421  [M=108]
Accession:   PF04239.12
Description: Protein of unknown function (DUF421)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.2e-20   57.3   0.0    8.5e-20   56.9   0.0    1.2  1  VIMSS302853  


Domain annotation for each sequence (and alignments):
>> VIMSS302853  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   56.9   0.0   8.5e-20   8.5e-20       2      68 ..     104     169 ..     103     191 .. 0.90

  Alignments for each domain:
  == domain 1  score: 56.9 bits;  conditional E-value: 8.5e-20
       DUF421   2 lidgkpvvlienGkldeknlkklrltvddLleqLRqqgifslsdVkyailEtnGqlsvllkeekkpv 68 
                  l++gkpvv+ie+G+l  ++l++ ++t  ++ ++LR +g+++l +V+ ailEtnGq+sv+  e++k v
  VIMSS302853 104 LLEGKPVVIIEDGELAWSKLNNSNMTEFEFFMELRLRGVEQLGQVRLAILETNGQISVYFFEDDK-V 169
                  799*******************************************************9998865.3 PP



Or compare VIMSS302853 to CDD or PaperBLAST