PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS8503918 to PF04239 (DUF421)

VIMSS8503918 has 248 amino acids

Query:       DUF421  [M=108]
Accession:   PF04239.12
Description: Protein of unknown function (DUF421)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    5.8e-29   86.3   0.1    9.2e-29   85.7   0.1    1.3  1  VIMSS8503918  


Domain annotation for each sequence (and alignments):
>> VIMSS8503918  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   85.7   0.1   9.2e-29   9.2e-29       1     106 [.      96     197 ..      96     199 .. 0.95

  Alignments for each domain:
  == domain 1  score: 85.7 bits;  conditional E-value: 9.2e-29
        DUF421   1 klidgkpvvlienGkldeknlkklrltvddLleqLRqqgifslsdVkyailEtnGqlsvllkeekkpvtklplplivdGkiqkenLkkigkdeewLk 97 
                   k+i g+p +++ +Gk++++++ +++l++ d+++ +R+qgi+s++++  a++E+nGql+v +ke+ +     + ++  +G + + +L+ i+kde+wLk
  VIMSS8503918  96 KMIVGSPRPVVIKGKFLQEKFVEAGLDIGDFATLIRMQGIHSMKEIWNAQIEPNGQLTVQKKEDPHI----SNVVLNNGAMVEAALEVIDKDEDWLK 188
                   6899***********************************************************9554....469*********************** PP

        DUF421  98 kelkkkgik 106
                   +el+k+g++
  VIMSS8503918 189 AELQKQGYD 197
                   *******97 PP



Or compare VIMSS8503918 to CDD or PaperBLAST