PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS92458 to PF04239 (DUF421)

VIMSS92458 has 230 amino acids

Query:       DUF421  [M=108]
Accession:   PF04239.12
Description: Protein of unknown function (DUF421)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    5.3e-20   57.5   0.0    7.2e-20   57.1   0.0    1.2  1  VIMSS92458  


Domain annotation for each sequence (and alignments):
>> VIMSS92458  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   57.1   0.0   7.2e-20   7.2e-20       2      68 ..     104     170 ..     103     192 .. 0.90

  Alignments for each domain:
  == domain 1  score: 57.1 bits;  conditional E-value: 7.2e-20
      DUF421   2 lidgkpvvlienGkldeknlkklrltvddLleqLRqqgifslsdVkyailEtnGqlsvllkeekkpv 68 
                 l++gkpvv+ie+G+l  ++l++ ++t  ++ ++LR +g+++l +V+ ailEtnGq+sv+  e++k  
  VIMSS92458 104 LLEGKPVVIIEDGELAWSKLNNSNMTEFEFFMELRLRGVEQLGQVRLAILETNGQISVYFFEDDKVK 170
                 799*******************************************************999986644 PP



Or compare VIMSS92458 to CDD or PaperBLAST