PaperBLAST – Find papers about a protein or its homologs

 

Align WP_000174457.1 to PF04239 (DUF421)

WP_000174457.1 has 211 amino acids

Query:       DUF421  [M=108]
Accession:   PF04239.12
Description: Protein of unknown function (DUF421)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    4.8e-35  105.9   0.2    7.5e-35  105.3   0.2    1.3  1  WP_000174457.1  


Domain annotation for each sequence (and alignments):
>> WP_000174457.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  105.3   0.2   7.5e-35   7.5e-35       1     106 [.      89     190 ..      89     192 .. 0.96

  Alignments for each domain:
  == domain 1  score: 105.3 bits;  conditional E-value: 7.5e-35
          DUF421   1 klidgkpvvlienGkldeknlkklrltvddLleqLRqqgifslsdVkyailEtnGqlsvllkeekkpvtklplplivdGkiqkenLkkigkdeew 95 
                     +lidgkp++li+nG++d +++++++l++++++ +LR+qgif++++Vk+a+ E+nGql v++ ++++p     +p+++dG iq + L++ig++eew
  WP_000174457.1  89 RLIDGKPTLLIKNGQIDPEACRSVGLSASEVALKLRSQGIFQMKQVKRAVQEQNGQLIVVQMGDENPK----YPVVTDGVIQVDVLESIGRNEEW 179
                     68**************************************************************7654....6********************** PP

          DUF421  96 Lkkelkkkgik 106
                     L ++l+k+g++
  WP_000174457.1 180 LLDNLSKQGHD 190
                     ********986 PP



Or compare WP_000174457.1 to CDD or PaperBLAST