VIMSS102820 has 122 amino acids
Query: DUF423 [M=87]
Accession: PF04241.19
Description: Protein of unknown function (DUF423)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.7e-35 107.4 4.1 2.9e-35 106.7 4.1 1.4 1 VIMSS102820
Domain annotation for each sequence (and alignments):
>> VIMSS102820
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 106.7 4.1 2.9e-35 2.9e-35 2 87 .] 19 103 .. 18 103 .. 0.98
Alignments for each domain:
== domain 1 score: 106.7 bits; conditional E-value: 2.9e-35
DUF423 2 GAfGaHglkkkleeeqlevfetavqYqlyhalallavallaeaaaakllklagllflaGivlFSgslyllaltgdkllgaitPiGG 87
GAfGaHgl+ k+++++l+v+e+a++Yq+yh+lall+++++ + +++ +++ag+l++aGi++FSgsly+l+lt++k+lgaitPiGG
VIMSS102820 19 GAFGAHGLQGKISDHYLSVWEKATTYQMYHGLALLIIGVI-SGTTSINVNWAGWLIFAGIIFFSGSLYILVLTQIKVLGAITPIGG 103
9**********999*************************9.89999***************************************9 PP
Or compare VIMSS102820 to CDD or PaperBLAST