VIMSS527431 has 103 amino acids
Query: DUF440 [M=101] Accession: PF04269.16 Description: Protein of unknown function, DUF440 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-46 142.2 2.0 3.3e-46 142.1 2.0 1.0 1 VIMSS527431 Domain annotation for each sequence (and alignments): >> VIMSS527431 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 142.1 2.0 3.3e-46 3.3e-46 2 101 .] 4 103 .] 3 103 .] 0.98 Alignments for each domain: == domain 1 score: 142.1 bits; conditional E-value: 3.3e-46 DUF440 2 ltedellekaydiFlelaadnLdpadillfnlefeerGaveevepeddWeeevgvevdkeefaevliGLeeeddelddiFarlLisrekeekechilW 99 lt+de+++ aydiFle+a ++L+padillfnl+feerGave+ve++d Weee+g +d+ faev++GL +++de+dd+Far+Lis++ e++e+h++W VIMSS527431 4 LTPDEAIDIAYDIFLEMAGEHLEPADILLFNLQFEERGAVEMVETSDRWEEEIGTLIDPTAFAEVWVGLVNDKDEMDDVFARFLISHQAENREYHVIW 101 799*********************************************************************************************** PP DUF440 100 kk 101 k+ VIMSS527431 102 KE 103 96 PP
Or compare VIMSS527431 to CDD or PaperBLAST