VIMSS527431 has 103 amino acids
Query: DUF440 [M=101]
Accession: PF04269.16
Description: Protein of unknown function, DUF440
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3e-46 142.2 2.0 3.3e-46 142.1 2.0 1.0 1 VIMSS527431
Domain annotation for each sequence (and alignments):
>> VIMSS527431
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 142.1 2.0 3.3e-46 3.3e-46 2 101 .] 4 103 .] 3 103 .] 0.98
Alignments for each domain:
== domain 1 score: 142.1 bits; conditional E-value: 3.3e-46
DUF440 2 ltedellekaydiFlelaadnLdpadillfnlefeerGaveevepeddWeeevgvevdkeefaevliGLeeeddelddiFarlLisrekeekechilW 99
lt+de+++ aydiFle+a ++L+padillfnl+feerGave+ve++d Weee+g +d+ faev++GL +++de+dd+Far+Lis++ e++e+h++W
VIMSS527431 4 LTPDEAIDIAYDIFLEMAGEHLEPADILLFNLQFEERGAVEMVETSDRWEEEIGTLIDPTAFAEVWVGLVNDKDEMDDVFARFLISHQAENREYHVIW 101
799*********************************************************************************************** PP
DUF440 100 kk 101
k+
VIMSS527431 102 KE 103
96 PP
Or compare VIMSS527431 to CDD or PaperBLAST