PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS7791 to PF04269 (DUF440)

VIMSS7791 has 107 amino acids

Query:       DUF440  [M=101]
Accession:   PF04269.12
Description: Protein of unknown function, DUF440
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------  -----------
    1.3e-50  156.3   2.8    1.4e-50  156.1   2.8    1.0  1  VIMSS7791  


Domain annotation for each sequence (and alignments):
>> VIMSS7791  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  156.1   2.8   1.4e-50   1.4e-50       2     101 .]       8     107 .]       7     107 .] 0.98

  Alignments for each domain:
  == domain 1  score: 156.1 bits;  conditional E-value: 1.4e-50
     DUF440   2 ltedealdqaydiFlelaadnLdpadillfnlqfeerGavelvepaedWeeevgvevdkeeyaevliGLeeeqdelddiFariLisrdkdekechilWke 101
                l++d a+d+aydiFle+a +nLdpadillfnlqfeerG+ve+ve+a+dWeee+gv +d+eeyaev++GL++eqde+dd+Fa++Lis++++++e+h++Wk+
  VIMSS7791   8 LDPDTAIDIAYDIFLEMAGENLDPADILLFNLQFEERGGVEFVETADDWEEEIGVLIDPEEYAEVWVGLVNEQDEMDDVFAKFLISHREEDREFHVIWKK 107
                689***********************************************************************************************96 PP



Or compare VIMSS7791 to CDD or PaperBLAST