VIMSS7791 has 107 amino acids
Query: DUF440 [M=101] Accession: PF04269.16 Description: Protein of unknown function, DUF440 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.9e-49 150.5 3.1 8.8e-49 150.3 3.1 1.0 1 VIMSS7791 Domain annotation for each sequence (and alignments): >> VIMSS7791 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 150.3 3.1 8.8e-49 8.8e-49 2 101 .] 8 107 .] 7 107 .] 0.98 Alignments for each domain: == domain 1 score: 150.3 bits; conditional E-value: 8.8e-49 DUF440 2 ltedellekaydiFlelaadnLdpadillfnlefeerGaveevepeddWeeevgvevdkeefaevliGLeeeddelddiFarlLisrekeekechilWkk 101 l++d +++ aydiFle+a +nLdpadillfnl+feerG+ve ve++ddWeee+gv +d+ee+aev++GL +e+de+dd+Fa++Lis+++e++e+h++Wkk VIMSS7791 8 LDPDTAIDIAYDIFLEMAGENLDPADILLFNLQFEERGGVEFVETADDWEEEIGVLIDPEEYAEVWVGLVNEQDEMDDVFAKFLISHREEDREFHVIWKK 107 6799**********************************************************************************************96 PP
Or compare VIMSS7791 to CDD or PaperBLAST