VIMSS16876 has 109 amino acids
Query: DUF446 [M=98]
Accession: PF04287.16
Description: tRNA pseudouridine synthase C
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.3e-39 118.3 2.6 7.1e-39 118.2 2.6 1.0 1 VIMSS16876
Domain annotation for each sequence (and alignments):
>> VIMSS16876
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 118.2 2.6 7.1e-39 7.1e-39 2 98 .] 7 103 .. 6 103 .. 0.98
Alignments for each domain:
== domain 1 score: 118.2 bits; conditional E-value: 7.1e-39
DUF446 2 vaelLeeleaeLrelelWqeeapseealastePFavdtlefeeWLqwvfiprmkalieaeqpLPkavaiapmaeealkeeeeekeellallkelDel 98
v+ +L++lea Lre+++W++++p++++++st+PF++dt+e+ eWLqwv+iprm+ l++++qpLP a+a+ap++e+al++++ +++ +la+l++lD+l
VIMSS16876 7 VRLQLQALEALLREHQHWRNDEPQPHQFNSTQPFFMDTMEPLEWLQWVLIPRMHDLLDNKQPLPGAFAVAPYYEMALATDHPQRALILAELEKLDAL 103
6789*******************************************************************************************86 PP
Or compare VIMSS16876 to CDD or PaperBLAST