PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS139582 to PF04301 (DUF452)

VIMSS139582 has 215 amino acids

Query:       DUF452  [M=213]
Accession:   PF04301.13
Description: Protein of unknown function (DUF452)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   3.8e-142  457.1   0.1   4.3e-142  456.9   0.1    1.0  1  VIMSS139582  


Domain annotation for each sequence (and alignments):
>> VIMSS139582  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  456.9   0.1  4.3e-142  4.3e-142       1     213 []       1     212 [.       1     212 [. 1.00

  Alignments for each domain:
  == domain 1  score: 456.9 bits;  conditional E-value: 4.3e-142
       DUF452   1 mktkfisqqgdnlilyfagwgtppdvvehlilpenydlllcydyrdlnldvdfsayrhirlvawsmgvwvaervlqgirlksatavngtglpcddqyg 98 
                  m+tkf+++qg++lilyfagwgtppd+v+hlilpen+dll+cydy+dlnld+dfsayrhirlvawsmgvw+aer+lqgirlksatavngtglpcdd++g
  VIMSS139582   1 METKFYNHQGGHLILYFAGWGTPPDAVNHLILPENHDLLICYDYQDLNLDFDFSAYRHIRLVAWSMGVWAAERALQGIRLKSATAVNGTGLPCDDNFG 98 
                  9************************************************************************************************* PP

       DUF452  99 ipeavfkgtlenltedtrlkferricgdkalledyqqysarptlqeihaelialyallqqdrrtdlirwskalvgskdkifmaanqraywtdrcavre 196
                  ip++vfkgtlenlte+trlkferr+cgdka++edyqq++arp ++eih+elial+a+++qdrrtdlirw++alvgs+dkifm+anq++ywt+rc+vre
  VIMSS139582  99 IPCTVFKGTLENLTENTRLKFERRMCGDKASFEDYQQFPARP-FGEIHQELIALFAMIGQDRRTDLIRWTNALVGSGDKIFMPANQHRYWTPRCTVRE 195
                  ******************************************.******************************************************* PP

       DUF452 197 idvehllfsrfthweal 213
                  idv+h+lfsrfthw+al
  VIMSS139582 196 IDVGHYLFSRFTHWSAL 212
                  **************985 PP



Or compare VIMSS139582 to CDD or PaperBLAST