PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS2124290 to PF04301 (DUF452)

VIMSS2124290 has 219 amino acids

Query:       DUF452  [M=213]
Accession:   PF04301.13
Description: Protein of unknown function (DUF452)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    2.8e-84  268.0   0.1    3.1e-84  267.8   0.1    1.0  1  VIMSS2124290  


Domain annotation for each sequence (and alignments):
>> VIMSS2124290  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  267.8   0.1   3.1e-84   3.1e-84       1     212 [.       1     215 [.       1     216 [. 0.96

  Alignments for each domain:
  == domain 1  score: 267.8 bits;  conditional E-value: 3.1e-84
        DUF452   1 mktkfisqqgdnlilyfagwgtppdvvehlilpenydlllcydyrdlnl.dvdfsayrhirlvawsmgvwvaervlqgirlksatavngtglpcddq 96 
                   mktk is q  nli+yfagwgtp +vv hl lp+ ydll+cydy+dln   +dfs y+ +rlvawsmgvwvae+vl  i+l sata+ngt +p  d 
  VIMSS2124290   1 MKTKLISTQQANLIIYFAGWGTPASVVSHLALPNGYDLLICYDYQDLNFpAFDFSRYQTVRLVAWSMGVWVAEKVLPEINLASATAINGTLFPKHDL 97 
                   9***********************************************8469********************************************* PP

        DUF452  97 ygipeavfkgtlenltedtrlkferricgdkalledyqqysarptlqeihaelialyallqqdrrtdlirwskalvgskdkifmaanqraywtdr.c 192
                   +gip  +f gtl++l+ ++rlkferr+cgdk ll+ y   + + +l eih+el  l + ++ +  t  ++w++ ++g kd+if a+nq a+w+d+ +
  VIMSS2124290  98 WGIPLQIFDGTLQTLNAENRLKFERRMCGDKQLLNVYLALPEQRSLAEIHHELEVLNTAIEANLVTPKLHWTNVIIGEKDRIFSAQNQLAFWQDKkV 194
                   *********************************************************************************************9725 PP

        DUF452 193 avrei.dvehllfsrfthwea 212
                    ++ + ++eh+l+++f+ we 
  VIMSS2124290 195 RMTHLsKGEHYLWQHFSEWEQ 215
                   577763689**********96 PP



Or compare VIMSS2124290 to CDD or PaperBLAST