PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS562857 to PF04301 (DUF452)

VIMSS562857 has 228 amino acids

Query:       DUF452  [M=213]
Accession:   PF04301.13
Description: Protein of unknown function (DUF452)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    9.9e-62  194.3   0.0    1.1e-61  194.2   0.0    1.0  1  VIMSS562857  


Domain annotation for each sequence (and alignments):
>> VIMSS562857  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  194.2   0.0   1.1e-61   1.1e-61       9     212 ..      11     225 ..       1     226 [. 0.88

  Alignments for each domain:
  == domain 1  score: 194.2 bits;  conditional E-value: 1.1e-61
       DUF452   9 qgdnlilyfagwgtppdvvehlilpenydlllcydyrdlnldvdfsayrhirlvawsmgvwvaervlqgirl...ksatavngtglpcddqygipeav 103
                  + ++lil+f gw    ++v hl +p +ydll ++dyr   l +d+s yr i l awsmgvw+aer  +  rl    sa a+ gtg p dd +gip  +
  VIMSS562857  11 DSNKLILFFNGWAMTREAVSHLAIPPEYDLLHVWDYRTDTLHFDWSPYREICLSAWSMGVWAAERLSREGRLpsvVSAVAICGTGYPMDDTMGIPLDI 108
                  5689*************************************************************99877763337899******************* PP

       DUF452 104 fkgtlenltedtrlkferricgdkalledyqqysarptlqeihaelialyallqqdrrtd......lirwskalvgskdkifmaanqraywtdr.ca. 193
                  f+gtl++lte++rl+f+rr+cg k+l +  +  +ar   +ei+ael  +y   ++  ++d       ++w kal+g+kd+i++a+nq+a+w+ r c  
  VIMSS562857 109 FRGTLDGLTEENRLRFNRRMCGGKSLKHLLEALAARE-TDEIKAELGRVYEEEEKRLKSDdphpvaPLSWDKALIGAKDRIIPAKNQQAFWQMRgCRn 205
                  **************************999*******9.7***********865555444422222258************************995532 PP

       DUF452 194 vrei.dvehllfsrfthwea 212
                  +  + +++h+lf+rft we 
  VIMSS562857 206 IETVaEGDHYLFNRFTEWEQ 225
                  44442689**********96 PP



Or compare VIMSS562857 to CDD or PaperBLAST