PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS7890 to PF04301 (DUF452)

VIMSS7890 has 215 amino acids

Query:       DUF452  [M=213]
Accession:   PF04301.13
Description: Protein of unknown function (DUF452)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------  -----------
     8e-130  416.8   0.3   8.9e-130  416.7   0.3    1.0  1  VIMSS7890  


Domain annotation for each sequence (and alignments):
>> VIMSS7890  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  416.7   0.3  8.9e-130  8.9e-130       1     213 []       1     212 [.       1     212 [. 1.00

  Alignments for each domain:
  == domain 1  score: 416.7 bits;  conditional E-value: 8.9e-130
     DUF452   1 mktkfisqqgdnlilyfagwgtppdvvehlilpenydlllcydyrdlnldvdfsayrhirlvawsmgvwvaervlqgirlksatavngtglpcddqygip 100
                mktkf++ qg++lilyfagwgtppd+v+hlilpen+dll+cydy+dlnld+d+sayrhirlvawsmgvwvaervlqgirlksatavngtglpcdd +gip
  VIMSS7890   1 MKTKFYDYQGEHLILYFAGWGTPPDAVNHLILPENHDLLICYDYQDLNLDFDLSAYRHIRLVAWSMGVWVAERVLQGIRLKSATAVNGTGLPCDDSFGIP 100
                9*************************************************************************************************** PP

     DUF452 101 eavfkgtlenltedtrlkferricgdkalledyqqysarptlqeihaelialyallqqdrrtdlirwskalvgskdkifmaanqraywtdrcavreidve 200
                 a+fkgtlenlte+trlkferricgdka++e yq ++arp ++eih+el+al+a++qqd+r dli+w++a v s+dkif++anq++yw  rcav+ei++e
  VIMSS7890 101 YAIFKGTLENLTENTRLKFERRICGDKASFERYQLFPARP-FDEIHQELTALFAMIQQDKRIDLIHWANAWVSSRDKIFTPANQHQYWALRCAVQEIEGE 199
                ****************************************.*********************************************************** PP

     DUF452 201 hllfsrfthweal 213
                h++fsrfthw+al
  VIMSS7890 200 HYVFSRFTHWSAL 212
                **********985 PP



Or compare VIMSS7890 to CDD or PaperBLAST