PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS819628 to PF04301 (DUF452)

VIMSS819628 has 215 amino acids

Query:       DUF452  [M=213]
Accession:   PF04301.13
Description: Protein of unknown function (DUF452)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   1.1e-137  442.5   0.1   1.2e-137  442.4   0.1    1.0  1  VIMSS819628  


Domain annotation for each sequence (and alignments):
>> VIMSS819628  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  442.4   0.1  1.2e-137  1.2e-137       1     213 []       1     212 [.       1     212 [. 1.00

  Alignments for each domain:
  == domain 1  score: 442.4 bits;  conditional E-value: 1.2e-137
       DUF452   1 mktkfisqqgdnlilyfagwgtppdvvehlilpenydlllcydyrdlnldvdfsayrhirlvawsmgvwvaervlqgirlksatavngtglpcddqyg 98 
                  mktkf+++qg++lilyfagwg ppd+v+hlilpen+dll+cydy+dlnld+dfsayrhirlvawsmgvw+aer+lqgirlksatavngtglpcdd++g
  VIMSS819628   1 MKTKFYNHQGEHLILYFAGWGMPPDAVNHLILPENHDLLICYDYQDLNLDFDFSAYRHIRLVAWSMGVWAAERALQGIRLKSATAVNGTGLPCDDNFG 98 
                  9************************************************************************************************* PP

       DUF452  99 ipeavfkgtlenltedtrlkferricgdkalledyqqysarptlqeihaelialyallqqdrrtdlirwskalvgskdkifmaanqraywtdrcavre 196
                  ip+avfkgtlenlte+tr kferricgdka++edyqq++arp ++eih+el+al+a+++qdrrtdlirw++al gs+dkif++anq++ywt+rc+v+e
  VIMSS819628  99 IPCAVFKGTLENLTENTRSKFERRICGDKASFEDYQQFPARP-FDEIHQELTALFAMIGQDRRTDLIRWTNALFGSGDKIFIPANQHRYWTPRCTVQE 195
                  ******************************************.******************************************************* PP

       DUF452 197 idvehllfsrfthweal 213
                   d++h+lfsrfthw+al
  VIMSS819628 196 TDGGHYLFSRFTHWSAL 212
                  **************985 PP



Or compare VIMSS819628 to CDD or PaperBLAST