VIMSS2125200 has 129 amino acids
Query: DUF454 [M=115] Accession: PF04304.17 Description: Protein of unknown function (DUF454) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-43 131.7 5.4 7.4e-43 131.5 5.4 1.0 1 VIMSS2125200 Domain annotation for each sequence (and alignments): >> VIMSS2125200 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 131.5 5.4 7.4e-43 7.4e-43 1 112 [. 2 114 .. 2 117 .. 0.97 Alignments for each domain: == domain 1 score: 131.5 bits; conditional E-value: 7.4e-43 DUF454 1 rllllvlGllslalGviGivlPlLPTtpFlLlAafcfarssprlerwLlehklfgpyirdwrekraiplkaKvialllmalsllislllveslwvki 97 +l++++ G+l+++lG++G++lP+LPTtpFlLl+ fcf +ssprl++w++++k++++y++++ ekra+++k+Kv++ll+ a ++l+s++ +++w k+ VIMSS2125200 2 KLFYIITGFLCIGLGILGAILPGLPTTPFLLLSLFCFGKSSPRLQQWFMRTKIYQKYLKEYDEKRAMTMKQKVTILLISAPFCLVSFFALPNIWGKL 98 689********************************************************************************************** PP DUF454 98 llalvlllvllyl.lr 112 +l++v+++ ++y+ ++ VIMSS2125200 99 TLIAVIICQYWYFfCK 114 ************9555 PP
Or compare VIMSS2125200 to CDD or PaperBLAST