VIMSS216701 has 137 amino acids
Query: DUF454 [M=115] Accession: PF04304.17 Description: Protein of unknown function (DUF454) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-40 122.7 4.0 4.4e-40 122.6 4.0 1.0 1 VIMSS216701 Domain annotation for each sequence (and alignments): >> VIMSS216701 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 122.6 4.0 4.4e-40 4.4e-40 1 115 [] 11 125 .. 11 125 .. 0.98 Alignments for each domain: == domain 1 score: 122.6 bits; conditional E-value: 4.4e-40 DUF454 1 rllllvlGllslalGviGivlPlLPTtpFlLlAafcfarssprlerwLlehklfgpyirdwrekraiplkaKvialllmalsllislllveslwvkil 98 rl + +l+++sl++G++ iv+P+LPTt F+LlAa++++rssprl +wL +h+lfgp++++wr+++ i+++aKv a+++m+l+++++l++ e++w +l VIMSS216701 11 RLSYGILAYVSLGVGLVAIVIPGLPTTEFILLAAWAATRSSPRLSAWLENHRLFGPILHNWRNGKVIQRRAKVSATISMLLCAGLMLTFLEHHWPVFL 108 567899******************************************************************************************** PP DUF454 99 lalvlllvllyllrlpt 115 ++ ++l l+++++p+ VIMSS216701 109 AIAGMTLGNLWIWSRPE 125 **************996 PP
Or compare VIMSS216701 to CDD or PaperBLAST