VIMSS357031 has 128 amino acids
Query: DUF454 [M=115] Accession: PF04304.17 Description: Protein of unknown function (DUF454) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-33 100.7 6.7 3e-33 100.5 6.7 1.0 1 VIMSS357031 Domain annotation for each sequence (and alignments): >> VIMSS357031 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 100.5 6.7 3e-33 3e-33 1 111 [. 3 114 .. 3 119 .. 0.96 Alignments for each domain: == domain 1 score: 100.5 bits; conditional E-value: 3e-33 DUF454 1 rllllvlGllslalGviGivlPlLPTtpFlLlAafcfarssprlerwLlehklfgpyirdwrekraiplkaKvialllmalsllislllveslwvkil 98 +l++++lG +++alG++Gi+lPlLPTt F+Ll+af+++rss++l++ +l+++++++yi++ +++i++k K+ +++m l+++i +l+v++++++++ VIMSS357031 3 KLFFIFLGSCTFALGTLGIFLPLLPTTGFYLLTAFFWMRSSDKLYNKFLASSYYQKYIQEAFFEKKITRKGKWKLFISMFLLFAIPCLIVRNTLMTTT 100 6899********************************************************************************************** PP DUF454 99 lalvlllvllyl.l 111 la+v+l++++ l + VIMSS357031 101 LAIVYLAHVIGLsW 114 *******9998765 PP
Or compare VIMSS357031 to CDD or PaperBLAST