PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS357031 to PF04304 (DUF454)

VIMSS357031 has 128 amino acids

Query:       DUF454  [M=115]
Accession:   PF04304.17
Description: Protein of unknown function (DUF454)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.6e-33  100.7   6.7      3e-33  100.5   6.7    1.0  1  VIMSS357031  


Domain annotation for each sequence (and alignments):
>> VIMSS357031  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  100.5   6.7     3e-33     3e-33       1     111 [.       3     114 ..       3     119 .. 0.96

  Alignments for each domain:
  == domain 1  score: 100.5 bits;  conditional E-value: 3e-33
       DUF454   1 rllllvlGllslalGviGivlPlLPTtpFlLlAafcfarssprlerwLlehklfgpyirdwrekraiplkaKvialllmalsllislllveslwvkil 98 
                  +l++++lG +++alG++Gi+lPlLPTt F+Ll+af+++rss++l++ +l+++++++yi++   +++i++k K+  +++m l+++i +l+v++++++++
  VIMSS357031   3 KLFFIFLGSCTFALGTLGIFLPLLPTTGFYLLTAFFWMRSSDKLYNKFLASSYYQKYIQEAFFEKKITRKGKWKLFISMFLLFAIPCLIVRNTLMTTT 100
                  6899********************************************************************************************** PP

       DUF454  99 lalvlllvllyl.l 111
                  la+v+l++++ l +
  VIMSS357031 101 LAIVYLAHVIGLsW 114
                  *******9998765 PP



Or compare VIMSS357031 to CDD or PaperBLAST