VIMSS5212469 has 146 amino acids
Query: DUF454 [M=115] Accession: PF04304.17 Description: Protein of unknown function (DUF454) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-41 126.5 7.4 3e-41 126.3 7.4 1.1 1 VIMSS5212469 Domain annotation for each sequence (and alignments): >> VIMSS5212469 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 126.3 7.4 3e-41 3e-41 1 112 [. 33 144 .. 33 146 .] 0.98 Alignments for each domain: == domain 1 score: 126.3 bits; conditional E-value: 3e-41 DUF454 1 rllllvlGllslalGviGivlPlLPTtpFlLlAafcfarssprlerwLlehklfgpyirdwrekraiplkaKvialllmalsllislllveslwvki 97 r++++ l++l++alG++Gi++P+LPT+ F++lA+f++ar+s++l++w+ +h+++gp+ir+w+e+r ip kaK+i++l+m+l++++++++++++w+ + VIMSS5212469 33 RWVFISLAWLCIALGILGIFIPGLPTVDFMILAVFFAARGSEKLHQWFRNHRYIGPLIREWQEHRRIPKKAKYISTLSMSLAAGLMIWTIPHPWFVY 129 89*********************************************************************************************** PP DUF454 98 llalvlllvllyllr 112 +l++++vl++++ VIMSS5212469 130 PAILCMAGVLAWMWL 144 *************96 PP
Or compare VIMSS5212469 to CDD or PaperBLAST