WP_001189860.1 has 125 amino acids
Query: DUF454 [M=115] Accession: PF04304.17 Description: Protein of unknown function (DUF454) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-45 139.5 16.0 2.7e-45 139.4 16.0 1.0 1 WP_001189860.1 Domain annotation for each sequence (and alignments): >> WP_001189860.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 139.4 16.0 2.7e-45 2.7e-45 1 114 [. 3 116 .. 3 117 .. 0.99 Alignments for each domain: == domain 1 score: 139.4 bits; conditional E-value: 2.7e-45 DUF454 1 rllllvlGllslalGviGivlPlLPTtpFlLlAafcfarssprlerwLlehklfgpyirdwrekraiplkaKvialllmalsllislllveslwv 95 r++l+++G+l+++lG++G+vlPlLPTtpF+LlAa+cfarsspr+++wLl +++fg y+r+w++ ra+p aK +a++l++l+++isl+lv+++wv WP_001189860.1 3 RTILIIIGWLAVVLGTLGVVLPLLPTTPFILLAAWCFARSSPRFHAWLLYRSWFGGYLRHWQRYRAMPPGAKPRAIALILLTFGISLWLVNMMWV 97 789******************************************************************************************** PP DUF454 96 killalvlllvllyllrlp 114 ++ll+++l+++l++++r+p WP_001189860.1 98 RVLLLVILACLLIFMWRIP 116 *****************98 PP
Or compare WP_001189860.1 to CDD or PaperBLAST