VIMSS1941116 has 97 amino acids
Query: DUF485 [M=89]
Accession: PF04341.15
Description: Protein of unknown function, DUF485
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.4e-16 45.9 1.6 2.8e-16 45.6 1.6 1.0 1 VIMSS1941116
Domain annotation for each sequence (and alignments):
>> VIMSS1941116
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 45.6 1.6 2.8e-16 2.8e-16 2 84 .. 12 91 .. 11 94 .. 0.94
Alignments for each domain:
== domain 1 score: 45.6 bits; conditional E-value: 2.8e-16
DUF485 2 aspkFqeLvrkrrrfafpltaiflvvYfgfvllvafapdllatkvgegnitvgivlglgqfvltfvltglYvrrAnrefDpla 84
++++ q L+ +r+ ++f l+a++l++++ +++l +f+ +ll v++g +tv+++++++qfv+++v++ +Y+ rA + +D ++
VIMSS1941116 12 QNSDLQVLADTRAALTFRLSALVLALFLPLPILGGFT-SLLDGVVFSG-VTVAWLYAVAQFVVAIVVARYYMARAAE-LDSRT 91
5788999******************************.********76.**************************98.88876 PP
Or compare VIMSS1941116 to CDD or PaperBLAST