VIMSS1941116 has 97 amino acids
Query: DUF485 [M=89]
Accession: PF04341.16
Description: Protein of unknown function, DUF485
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.8e-16 46.2 1.5 2.1e-16 46.0 1.5 1.0 1 VIMSS1941116
Domain annotation for each sequence (and alignments):
>> VIMSS1941116
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 46.0 1.5 2.1e-16 2.1e-16 3 84 .. 13 91 .. 11 94 .. 0.94
Alignments for each domain:
== domain 1 score: 46.0 bits; conditional E-value: 2.1e-16
DUF485 3 spkFqeLvrkrrrfafpltaiflvvYflfvllvafapdllatkvvegnitvgillgllqfvltfvltglYvrrAnrefDpla 84
+++ q L+ +r+ ++f l+a++l++++ +++l +f+ +ll v++g +tv++l++++qfv+++v++ +Y+ rA + +D ++
VIMSS1941116 13 NSDLQVLADTRAALTFRLSALVLALFLPLPILGGFT-SLLDGVVFSG-VTVAWLYAVAQFVVAIVVARYYMARAAE-LDSRT 91
788999******************************.********66.**************************98.88876 PP
Or compare VIMSS1941116 to CDD or PaperBLAST