VIMSS218952 has 102 amino acids
Query: DUF485 [M=89]
Accession: PF04341.15
Description: Protein of unknown function, DUF485
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.2e-36 108.9 0.0 5.8e-36 108.7 0.0 1.0 1 VIMSS218952
Domain annotation for each sequence (and alignments):
>> VIMSS218952
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 108.7 0.0 5.8e-36 5.8e-36 2 88 .. 11 97 .. 10 98 .. 0.98
Alignments for each domain:
== domain 1 score: 108.7 bits; conditional E-value: 5.8e-36
DUF485 2 aspkFqeLvrkrrrfafpltaiflvvYfgfvllvafapdllatkvgegnitvgivlglgqfvltfvltglYvrrAnrefDplaeeir 88
++p+Fq+Lvr++rr+ lt+++lvvY+gfvllvaf+p+ l+++++ g++tvg+++g+++++l+f+ltg+Yv+rAn+ +Dpl+++++
VIMSS218952 11 NHPDFQHLVRRKRRLNGSLTLAMLVVYYGFVLLVAFSPSTLGQSLSGGVTTVGMLVGVLMVLLSFALTGIYVHRANNVLDPLNDKVK 97
79********************************************88************************************997 PP
Or compare VIMSS218952 to CDD or PaperBLAST