VIMSS319325 has 100 amino acids
Query: DUF485 [M=89]
Accession: PF04341.16
Description: Protein of unknown function, DUF485
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.8e-38 114.6 0.2 9.8e-38 114.4 0.2 1.0 1 VIMSS319325
Domain annotation for each sequence (and alignments):
>> VIMSS319325
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 114.4 0.2 9.8e-38 9.8e-38 2 89 .] 9 96 .. 8 96 .. 0.98
Alignments for each domain:
== domain 1 score: 114.4 bits; conditional E-value: 9.8e-38
DUF485 2 aspkFqeLvrkrrrfafpltaiflvvYflfvllvafapdllatkvvegnitvgillgllqfvltfvltglYvrrAnrefDplaeeire 89
++p++qeLvr+r++++++l+a++lvvYf+f+llva+ap++l++++++g++t+gi++gl+++vl+f+ltg+Yvr A +++D l ++i+e
VIMSS319325 9 RDPNYQELVRRRSSLGWMLSAVMLVVYFGFILLVAYAPKFLGIPLGSGVTTIGIPIGLSVIVLAFLLTGIYVRQASSSYDVLIRKIVE 96
78***********************************************************************************985 PP
Or compare VIMSS319325 to CDD or PaperBLAST