VIMSS326053 has 106 amino acids
Query: DUF485 [M=89] Accession: PF04341.15 Description: Protein of unknown function, DUF485 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-30 91.4 4.1 1.7e-30 91.2 4.1 1.0 1 VIMSS326053 Domain annotation for each sequence (and alignments): >> VIMSS326053 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 91.2 4.1 1.7e-30 1.7e-30 2 89 .] 15 102 .. 14 102 .. 0.98 Alignments for each domain: == domain 1 score: 91.2 bits; conditional E-value: 1.7e-30 DUF485 2 aspkFqeLvrkrrrfafpltaiflvvYfgfvllvafapdllatkvgegnitvgivlglgqfvltfvltglYvrrAnrefDplaeeire 89 a+ k+++L+r+r+ +++ lt+++lvvYfgf+ l+af++++la ++++g++t gi++++g++++++++t++Yv ++n +D+l+++i+e VIMSS326053 15 ANRKYHALKRQRNVLSWLLTLLMLVVYFGFIGLIAFNKAFLAVPLASGVTTRGIPIAIGVMLFAIIVTAVYVFFSNIVYDKLSRNILE 102 689*********************************************************************************9985 PP
Or compare VIMSS326053 to CDD or PaperBLAST