VIMSS382658 has 102 amino acids
Query: DUF485 [M=89]
Accession: PF04341.15
Description: Protein of unknown function, DUF485
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.6e-31 93.4 0.9 4.1e-31 93.2 0.9 1.1 1 VIMSS382658
Domain annotation for each sequence (and alignments):
>> VIMSS382658
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 93.2 0.9 4.1e-31 4.1e-31 2 88 .. 13 98 .. 12 99 .. 0.98
Alignments for each domain:
== domain 1 score: 93.2 bits; conditional E-value: 4.1e-31
DUF485 2 aspkFqeLvrkrrrfafpltaiflvvYfgfvllvafapdllatkvgegnitvgivlglgqfvltfvltglYvrrAnrefDplaeeir 88
++pkF eL+rk+++f++ ++++ v+Yf++++ +a+ap+l+++k+ g i++g++++l+qf++++ ++++Y+++An++fD+l++e++
VIMSS382658 13 RNPKFVELHRKKTTFLVGWWVFSTVFYFLLPIGAAYAPGLFKIKIL-GRINIGYLFALSQFFVSWGIAMYYAHVANKDFDRLTRELV 98
79********************************************.*************************************997 PP
Or compare VIMSS382658 to CDD or PaperBLAST