VIMSS639383 has 113 amino acids
Query: DUF485 [M=89] Accession: PF04341.15 Description: Protein of unknown function, DUF485 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.9e-29 85.9 1.1 9.2e-29 85.6 1.1 1.1 1 VIMSS639383 Domain annotation for each sequence (and alignments): >> VIMSS639383 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 85.6 1.1 9.2e-29 9.2e-29 2 88 .. 22 105 .. 21 106 .. 0.98 Alignments for each domain: == domain 1 score: 85.6 bits; conditional E-value: 9.2e-29 DUF485 2 aspkFqeLvrkrrrfafpltaiflvvYfgfvllvafapdllatkvgegnitvgivlglgqfvltfvltglYvrrAnrefDplaeeir 88 +s++Fq L +k+++f++p++++fl +++++++l++++ ++l+t+ + g +t+++v++++qf++t++l+++Y+++A++ fD+++++i+ VIMSS639383 22 QSEEFQLLLNKKKKFIVPMSIFFLSFFIALPILTSYS-KVLNTPAF-GDVTWAWVFAFAQFIMTWALCMIYSKKAES-FDEISQKIL 105 689**********************************.9*******.99****************************.*******97 PP
Or compare VIMSS639383 to CDD or PaperBLAST