VIMSS639383 has 113 amino acids
Query: DUF485 [M=89]
Accession: PF04341.16
Description: Protein of unknown function, DUF485
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.4e-29 86.2 1.1 7.5e-29 85.9 1.1 1.1 1 VIMSS639383
Domain annotation for each sequence (and alignments):
>> VIMSS639383
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 85.9 1.1 7.5e-29 7.5e-29 2 88 .. 22 105 .. 21 106 .. 0.98
Alignments for each domain:
== domain 1 score: 85.9 bits; conditional E-value: 7.5e-29
DUF485 2 aspkFqeLvrkrrrfafpltaiflvvYflfvllvafapdllatkvvegnitvgillgllqfvltfvltglYvrrAnrefDplaeeir 88
+s++Fq L +k+++f++p++++fl +++++++l++++ ++l+t+ + g +t++++++++qf++t++l+++Y+++A++ fD+ +++i+
VIMSS639383 22 QSEEFQLLLNKKKKFIVPMSIFFLSFFIALPILTSYS-KVLNTPAF-GDVTWAWVFAFAQFIMTWALCMIYSKKAES-FDEISQKIL 105
689**********************************.9*******.9*****************************.*******97 PP
Or compare VIMSS639383 to CDD or PaperBLAST