WP_000372818.1 has 110 amino acids
Query: DUF485 [M=89] Accession: PF04341.16 Description: Protein of unknown function, DUF485 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-34 102.7 0.2 5.1e-34 102.5 0.2 1.0 1 WP_000372818.1 Domain annotation for each sequence (and alignments): >> WP_000372818.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 102.5 0.2 5.1e-34 5.1e-34 2 87 .. 11 96 .. 10 98 .. 0.97 Alignments for each domain: == domain 1 score: 102.5 bits; conditional E-value: 5.1e-34 DUF485 2 aspkFqeLvrkrrrfafpltaiflvvYflfvllvafapdllatkvvegnitvgillgllqfvltfvltglYvrrAnrefDplaeei 87 ++pkFq++v+k++ ++++lt+i+lv+Y++f+llv++++++l + g++t+gi+lgl+++vl+f+l+g+Y+++An+++D+l+ee WP_000372818.1 11 RNPKFQKMVKKKSALSWTLTIIMLVLYVGFMLLVGYNKEFLMSSFSGGVTTWGIPLGLGIIVLSFLLCGVYSYIANNTLDQLSEEA 96 79********************************************88**********************************9985 PP
Or compare WP_000372818.1 to CDD or PaperBLAST