WP_013241470.1 has 113 amino acids
Query: DUF485 [M=89]
Accession: PF04341.16
Description: Protein of unknown function, DUF485
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.5e-39 119.5 2.3 2.9e-39 119.3 2.3 1.0 1 WP_013241470.1
Domain annotation for each sequence (and alignments):
>> WP_013241470.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 119.3 2.3 2.9e-39 2.9e-39 3 89 .] 24 109 .. 22 109 .. 0.98
Alignments for each domain:
== domain 1 score: 119.3 bits; conditional E-value: 2.9e-39
DUF485 3 spkFqeLvrkrrrfafpltaiflvvYflfvllvafapdllatkvvegnitvgillgllqfvltfvltglYvrrAnrefDplaeeire 89
sp+F+eL+r++r+f+fp++++f+v+Y++fv+++++apd+++tkvv g+i++g++lg+ qfv+tfv+t++Y+++An++++p+a++ire
WP_013241470.1 24 SPQFKELKRTYRSFTFPMSIAFFVWYLVFVIAATYAPDFMGTKVV-GSINLGVVLGITQFVTTFVITWIYIKYANKNIEPRARAIRE 109
8********************************************.***************************************96 PP
Or compare WP_013241470.1 to CDD or PaperBLAST