PaperBLAST – Find papers about a protein or its homologs

 

Align WP_088062182.1 to PF04341 (DUF485)

WP_088062182.1 has 105 amino acids

Query:       DUF485  [M=89]
Accession:   PF04341.15
Description: Protein of unknown function, DUF485
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.9e-37  113.4   0.4    2.2e-37  113.3   0.4    1.0  1  WP_088062182.1  


Domain annotation for each sequence (and alignments):
>> WP_088062182.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  113.3   0.4   2.2e-37   2.2e-37       2      89 .]      14     101 ..      13     101 .. 0.98

  Alignments for each domain:
  == domain 1  score: 113.3 bits;  conditional E-value: 2.2e-37
          DUF485   2 aspkFqeLvrkrrrfafpltaiflvvYfgfvllvafapdllatkvgegnitvgivlglgqfvltfvltglYvrrAnrefDplaeeire 89 
                     a+pk+++L+r+r+ ++++lt+++l++Yfg++ l+af++++lat++g+g++++gi++++g++v+t+v+t++YvrrAn+++D+l+++i+e
  WP_088062182.1  14 ANPKYHALKRQRNALGWTLTVLMLLAYFGYIGLIAFDKTFLATPIGDGVTSIGIPIAIGVMVFTIVITAIYVRRANNTYDQLTAQILE 101
                     79***********************************************************************************985 PP



Or compare WP_088062182.1 to CDD or PaperBLAST