WP_088062182.1 has 105 amino acids
Query: DUF485 [M=89] Accession: PF04341.15 Description: Protein of unknown function, DUF485 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-37 113.4 0.4 2.2e-37 113.3 0.4 1.0 1 WP_088062182.1 Domain annotation for each sequence (and alignments): >> WP_088062182.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 113.3 0.4 2.2e-37 2.2e-37 2 89 .] 14 101 .. 13 101 .. 0.98 Alignments for each domain: == domain 1 score: 113.3 bits; conditional E-value: 2.2e-37 DUF485 2 aspkFqeLvrkrrrfafpltaiflvvYfgfvllvafapdllatkvgegnitvgivlglgqfvltfvltglYvrrAnrefDplaeeire 89 a+pk+++L+r+r+ ++++lt+++l++Yfg++ l+af++++lat++g+g++++gi++++g++v+t+v+t++YvrrAn+++D+l+++i+e WP_088062182.1 14 ANPKYHALKRQRNALGWTLTVLMLLAYFGYIGLIAFDKTFLATPIGDGVTSIGIPIAIGVMVFTIVITAIYVRRANNTYDQLTAQILE 101 79***********************************************************************************985 PP
Or compare WP_088062182.1 to CDD or PaperBLAST