reanno::azobra:AZOBR_RS02935 has 100 amino acids
Query: DUF485 [M=89]
Accession: PF04341.15
Description: Protein of unknown function, DUF485
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.4e-41 126.8 0.2 1.5e-41 126.6 0.2 1.0 1 reanno::azobra:AZOBR_RS02935
Domain annotation for each sequence (and alignments):
>> reanno::azobra:AZOBR_RS02935
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 126.6 0.2 1.5e-41 1.5e-41 2 88 .. 10 96 .. 9 97 .. 0.98
Alignments for each domain:
== domain 1 score: 126.6 bits; conditional E-value: 1.5e-41
DUF485 2 aspkFqeLvrkrrrfafpltaiflvvYfgfvllvafapdllatkvgegnitvgivlglgqfvltfvltglYvrrAnrefDpla 84
a+pkFqeLv+kr+ fa++l++++lv+Yfgf+llvaf +++l+t++g+g++t+gi++gl+ ++++f+ltg+Yv+rAn+efD+l+
reanno::azobra:AZOBR_RS02935 10 ANPKFQELVQKRSAFAWTLSIAMLVIYFGFILLVAFGKGFLGTPIGSGVTTWGIPVGLFTIISAFILTGIYVHRANGEFDELN 92
69********************************************************************************* PP
DUF485 85 eeir 88
++i+
reanno::azobra:AZOBR_RS02935 93 RQIM 96
**97 PP
Or compare reanno::azobra:AZOBR_RS02935 to CDD or PaperBLAST