VIMSS3630033 has 95 amino acids
Query: DUF493 [M=84]
Accession: PF04359.18
Description: Protein of unknown function (DUF493)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.5e-28 84.9 0.0 2.7e-28 84.7 0.0 1.0 1 VIMSS3630033
Domain annotation for each sequence (and alignments):
>> VIMSS3630033
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 84.7 0.0 2.7e-28 2.7e-28 2 84 .] 13 95 .] 12 95 .] 0.97
Alignments for each domain:
== domain 1 score: 84.7 bits; conditional E-value: 2.7e-28
DUF493 2 elleFPcdfpikviGkaeeefeeavvevverhapefdpeevevrpSskgkYvSvtvtvtveskeqldaiyraLkahervkmvL 84
+l+ FP+d+pik iG+a+ee++ avv+++ +h p+fd+++++v++S++gkY+S+t++++ ++ eq++a+y++L a+++++ +L
VIMSS3630033 13 DLWVFPMDYPIKLIGDAGEELRIAVVDILVKHFPDFDQTTLKVQESRTGKYHSLTAQLRFDELEQVHALYADLAACPQIRTAL 95
6899***************************************************************************9876 PP
Or compare VIMSS3630033 to CDD or PaperBLAST