PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS144979 to PF04363 (DUF496)

VIMSS144979 has 105 amino acids

Query:       DUF496  [M=93]
Accession:   PF04363.16
Description: Protein of unknown function (DUF496)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    5.6e-51  156.9   9.5    6.3e-51  156.8   9.5    1.0  1  VIMSS144979  


Domain annotation for each sequence (and alignments):
>> VIMSS144979  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  156.8   9.5   6.3e-51   6.3e-51       1      93 []       9     101 ..       9     101 .. 0.98

  Alignments for each domain:
  == domain 1  score: 156.8 bits;  conditional E-value: 6.3e-51
       DUF496   1 lenvlelvrkarrknklkreiednekkirdnqkrvellenlleyikpdmsieeikaiienmksdyedrvddyiiknaelskerrelskklkel 93 
                  +++vle+vr++rrknkl+rei dnekkirdnqkrv+ll+nl+eyikp msiee++aii+nm++dyedrvddyiikna+lskerrelskklk++
  VIMSS144979   9 FQDVLEFVRMFRRKNKLQREIVDNEKKIRDNQKRVLLLDNLSEYIKPGMSIEEVQAIIANMRGDYEDRVDDYIIKNADLSKERRELSKKLKAM 101
                  689***************************************************************************************975 PP



Or compare VIMSS144979 to CDD or PaperBLAST