VIMSS153835 has 111 amino acids
Query: DUF496 [M=93] Accession: PF04363.16 Description: Protein of unknown function (DUF496) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-50 153.6 8.8 7e-50 153.4 8.8 1.0 1 VIMSS153835 Domain annotation for each sequence (and alignments): >> VIMSS153835 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 153.4 8.8 7e-50 7e-50 1 93 [] 8 100 .. 8 100 .. 0.98 Alignments for each domain: == domain 1 score: 153.4 bits; conditional E-value: 7e-50 DUF496 1 lenvlelvrkarrknklkreiednekkirdnqkrvellenlleyikpdmsieeikaiienmksdyedrvddyiiknaelskerrelskklkel 93 +++vle+vr +rrknkl+rei+d+ekkirdnqkrv+ll+nl++yikp ms+e i+ ii++mksdyedrvddyiiknae+skerr++skklk++ VIMSS153835 8 FQDVLEFVRLFRRKNKLQREIQDIEKKIRDNQKRVLLLDNLSDYIKPGMSVEAIQGIIASMKSDYEDRVDDYIIKNAEISKERRDISKKLKAM 100 689***************************************************************************************975 PP
Or compare VIMSS153835 to CDD or PaperBLAST